Gene Bio Systems
Recombinant Human Tumor necrosis factor receptor superfamily member 1B(TNFRSF1B),partial
Recombinant Human Tumor necrosis factor receptor superfamily member 1B(TNFRSF1B),partial
SKU:CSB-EP023978HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cell Biology
Uniprot ID: P20333
Gene Names: TNFRSF1B
Organism: Homo sapiens (Human)
AA Sequence: VAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTST
Expression Region: 27-203aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 46.3 kDa
Alternative Name(s): Tumor necrosis factor receptor 2 ;TNF-R2Tumor necrosis factor receptor type II ;TNF-RII ;TNFR-IIp75p80 TNF-alpha receptor; CD120bINN: Etanercept
Relevance: Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.
Reference: A second tumor necrosis factor receptor gene product can shed a naturally occurring tumor necrosis factor inhibitor.Kohno T., Brewer M.T., Baker S.L., Schwartz P.E., King M.W., Hale K.K., Squires C.H., Thompson R.C., Vannice J.L.Proc. Natl. Acad. Sci. U.S.A. 87:8331-8335(1990)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
