Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Tumor necrosis factor ligand superfamily member 14(TNFSF14)

Recombinant Human Tumor necrosis factor ligand superfamily member 14(TNFSF14)

SKU:CSB-CF023991HU

Regular price €1.520,95 EUR
Regular price Sale price €1.520,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O43557

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV

Protein Names:Recommended name: Tumor necrosis factor ligand superfamily member 14 Alternative name(s): Herpes virus entry mediator ligand Short name= HVEM-L Short name= Herpesvirus entry mediator ligand CD_antigen= CD258 Cleaved into the following 2 chains: 1. Tumor necrosis factor ligand superfamily member 14, membrane form 2. Tumor necrosis factor ligand superfamily member 14, soluble form

Gene Names:Name:TNFSF14 Synonyms:HVEML, LIGHT ORF Names:UNQ391/PRO726

Expression Region:1-240

Sequence Info:full length protein

View full details