Gene Bio Systems
Recombinant Human Tumor necrosis factor ligand superfamily member 14(TNFSF14)
Recombinant Human Tumor necrosis factor ligand superfamily member 14(TNFSF14)
SKU:CSB-CF023991HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:O43557
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Protein Names:Recommended name: Tumor necrosis factor ligand superfamily member 14 Alternative name(s): Herpes virus entry mediator ligand Short name= HVEM-L Short name= Herpesvirus entry mediator ligand CD_antigen= CD258 Cleaved into the following 2 chains: 1. Tumor necrosis factor ligand superfamily member 14, membrane form 2. Tumor necrosis factor ligand superfamily member 14, soluble form
Gene Names:Name:TNFSF14 Synonyms:HVEML, LIGHT ORF Names:UNQ391/PRO726
Expression Region:1-240
Sequence Info:full length protein
