Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Tryptase gamma(TPSG1)

Recombinant Human Tryptase gamma(TPSG1)

SKU:CSB-CF885710HU

Regular price €1.568,95 EUR
Regular price Sale price €1.568,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9NRR2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:IVGGHAAPAGAWPWQASLRLRRMHVCGGSLLSPQWVLTAAHCFSGSLNSSDYQVHLGELE ITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELSVPVTLSSRILPVCLPEASDDFCPGI RCWVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCARGPGDA CQDDSGGPLVCQVNGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWIRRHITASGGSES GYPRLPLLAGLFLPGLFLLLVSCVLLAKCLLHPSADGTPFPAPD

Protein Names:Recommended name: Tryptase gamma EC= 3.4.21.- Alternative name(s): Serine protease 31 Transmembrane tryptase Cleaved into the following 2 chains: 1. Tryptase gamma light chain 2. Tryptase gamma heavy chain

Gene Names:Name:TPSG1 Synonyms:PRSS31, TMT

Expression Region:38-321

Sequence Info:full length protein

View full details