Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Transmembrane protein 50A(TMEM50A)

Recombinant Human Transmembrane protein 50A(TMEM50A)

SKU:CSB-CF023849HU

Regular price €1.439,95 EUR
Regular price Sale price €1.439,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O95807

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSGFLEGLRCSECIDWGEKRNTIASIAAGVLFFTGWWIIIDAAVIYPTMKDFNHSYHACG VIATIAFLMINAVSNGQVRGDSYSEGCLGQTGARIWLFVGFMLAFGSLIASMWILFGGYV AKEKDIVYPGIAVFFQNAFIFFGGLVFKFGRTEDLWQ

Protein Names:Recommended name: Transmembrane protein 50A Alternative name(s): Small membrane protein 1

Gene Names:Name:TMEM50A Synonyms:SMP1 ORF Names:UNQ386/PRO718

Expression Region:1-157

Sequence Info:Full length protein

View full details