Recombinant Human Transmembrane 4 L6 family member 1 (TM4SF1), partial

SKU: P30408

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cancer

Uniprot ID: P30408

Gene Names: TM4SF1

Alternative Name(s): Membrane component chromosome 3 surface marker 1 Tumor-associated antigen L6

Abbreviation: Recombinant Human TM4SF1 protein, partial

Organism: Homo sapiens (Human)

Source: Yeast

Expression Region: 115-161aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: LAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVS

MW: 7.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance:

Reference: "Cloning and expression of the tumor-associated antigen L6."Marken J.S., Schieven G.L., Hellstroem I., Hellstroem K.E., Aruffo A.Proc. Natl. Acad. Sci. U.S.A. 89: 3503-3507(1992)

Function: