Gene Bio Systems
Recombinant Human TM2 domain-containing protein 1(TM2D1)
Recombinant Human TM2 domain-containing protein 1(TM2D1)
SKU:CSB-CF887145HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q9BX74
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:TSAGGEESLKCEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNE THFTGNEVGFFKPISCRNVNGYSYKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGFC GIGSLIDFILISMQIVGPSDGSSYIIDYYGTRLTRLSITNETFRKTQLYP
Protein Names:Recommended name: TM2 domain-containing protein 1 Alternative name(s): Beta-amyloid-binding protein Short name= hBBP
Gene Names:Name:TM2D1 Synonyms:BBP
Expression Region:38-207
Sequence Info:full length protein
