Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Thymic stromal lymphopoietin (TSLP) (R127A,R130A) (Active)

Recombinant Human Thymic stromal lymphopoietin (TSLP) (R127A,R130A) (Active)

SKU:Q969D9

Regular price €399,95 EUR
Regular price Sale price €399,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Immunology

Uniprot ID: Q969D9

Gene Names: TSLP

Alternative Name(s):

Abbreviation: Recombinant Human TSLP protein (R127A,R130A) (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 29-159aa(R127A,R130A)

Protein Length: Full Length of Mature Protein

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKARKAKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

MW: 16.6 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized human TSLP(R127A,R130A) at 2 μg/mL can bind Anti-TSLP recombinant antibody(CSB-RA025141MA2HU). The EC50 is 52.55-58.67 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Isoform 1 Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c+ dendritic cells. Can induce allergic inflammation by directly activating mast cells. Isoform 2 May act as an antimicrobial peptide in the oral cavity and on the skin.

Reference: Human thymic stromal lymphopoietin preferentially stimulates myeloid cells. Reche P.A., Soumelis V., Gorman D.M., Clifford T., Liu M.-R., Travis M., Zurawski S.M., Johnston J., Liu Y.-J., Bazan J.F. J. Immunol. 167: 336-343 (2001)

Function:

View full details