Gene Bio Systems
Recombinant Human Tetraspanin-2(TSPAN2),partial
Recombinant Human Tetraspanin-2(TSPAN2),partial
SKU:CSB-EP025157HU1e1
Couldn't load pickup availability
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Stem Cells
Uniprot ID:O60636
Gene Names:TSPAN2
Organism:Homo sapiens (Human)
AA Sequence:GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQL
Expression Region:112-188aa
Sequence Info:Partial
Source:E.coli
Tag Info:Tag-Free
MW:8.8 kDa
Alternative Name(s):Tspan-2 (Tetraspan NET-3)
Relevance:May play a role in signalling in oligodendrocytes in the early stages of their terminal differentiation into myelin-forming glia and may also function in stabilizing the mature sheath.
Reference:"New genetic associations detected in a host response study to hepatitis B vaccine." Davila S., Froeling F.E., Tan A., Bonnard C., Boland G.J., Snippe H., Hibberd M.L., Seielstad M. Genes Immun. 11:232-238(2010)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:3-7 business days
