Recombinant Human Sulfhydryl oxidase 1 (QSOX1), partial

SKU: O00391

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cell Biology

Uniprot ID: O00391

Gene Names: QSOX1

Alternative Name(s): (hQSOX)(Quiescin Q6)

Abbreviation: Recombinant Human QSOX1 protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 101-175aa

Protein Length: Partial

Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Target Protein Sequence: CAEETNSAVCRDFNIPGFPTVRFFKAFTKNGSGAVFPVAGADVQTLRERLIDALESHHDTWPPACPPLEPAKLEE

MW: 43.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Catalyzes the oxidation of sulfhydryl groups in peptide and protein thiols to disulfides with the reduction of oxygen to hydrogen peroxide. Plays a role in disulfide bond formation in a variety of extracellular proteins. In fibroblasts, required for normal incorporation of laminin into the extracellular matrix, and thereby for normal cell-cell adhesion and cell migration.

Reference: "Intracellular catalysis of disulfide bond formation by the human sulfhydryl oxidase, QSOX1." Chakravarthi S., Jessop C.E., Willer M., Stirling C.J., Bulleid N.J. Biochem. J. 404: 403-411(2007)

Function: