Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Sugar transporter SWEET1(SLC50A1)

Recombinant Human Sugar transporter SWEET1(SLC50A1)

SKU:CSB-CF866269HU

Regular price €1.503,95 EUR
Regular price Sale price €1.503,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9BRV3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSY GALKGDGILIVVNTVGAALQTLYILAYLHYCPRKRVVLLQTATLLGVLLLGYGYFWLLVP NPEARLQQLGLFCSVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGF RLRDPYIMVSNFPGIVTSFIRFWLFWKYPQEQDRNYWLLQT

Protein Names:Recommended name: Sugar transporter SWEET1 Short name= HsSWEET1 Alternative name(s): RAG1-activating protein 1 Solute carrier family 50 member 1 Stromal cell protein

Gene Names:Name:SLC50A1 Synonyms:RAG1AP1, SCP

Expression Region:1-221

Sequence Info:full length protein

View full details