Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Store-opeRated calcium entry-associated regulatory factor(SARAF),partial

Recombinant Human Store-opeRated calcium entry-associated regulatory factor(SARAF),partial

SKU:CSB-YP853392HU

Regular price €760,95 EUR
Regular price Sale price €760,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Biochemicals

Uniprot ID: Q96BY9

Gene Names: SARAF

Organism: Homo sapiens (Human)

AA Sequence: SDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR

Expression Region: 195-339aa

Sequence Info: Cytoplasmic Domain

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 17.5 kDa

Alternative Name(s): HBV X-transactivated gene 3 protein HBV XAg-transactivated protein 3 Protein FOAP-7 Transmembrane protein 66

Relevance: Negative regulator of store-operated Ca2+ entry (SOCE) involved in protecting cells from Ca2+ overfilling. In response to cytosolic Ca2+ elevation after endoplasmic reticulum Ca2+ refilling, promotes a slow inactivation of STIM (STIM1 or STIM2)-dependent SOCE activity: possibly act by facilitating the deoligomerization of STIM to efficiently turn off ORAI when the endoplasmic reticulum lumen is filled with the appropriate Ca2+ levels, and thus preventing the overload of the cell with excessive Ca2+ ions.

Reference: "Molecular cloning of a human novel gene, FOAP-7, which are highly expressed in macrophages."Fujii Y., Tsuritani K., Yajima Y., Amemiya T., Ukai Y., Naito K., Kawaguchi A., Takayama K.Submitted (JUN-1999)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details