Recombinant Human Sodium-potassium-transporting ATPase subunit gamma(FXYD2)

Recombinant Human Sodium-potassium-transporting ATPase subunit gamma(FXYD2)

CSB-EP009090HU
Regular price
€628,95 EUR
Sale price
€628,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Neuroscience

Uniprot ID: P54710

Gene Names: FXYD2

Organism: Homo sapiens (Human)

AA Sequence: MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP

Expression Region: 1-64aa

Sequence Info: Full Length of Isoform 2

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 34.4 kDa

Alternative Name(s): FXYD domain-containing ion transport regulator 2 Sodium pump gamma chain

Relevance: May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase.

Reference: "Dominant isolated renal magnesium loss is caused by misrouting of the Na+,K+-ATPase gamma-subunit." Meij I.C., Koenderink J.B., van Bokhoven H., Assink K.F.H., Groenestege W.T., de Pont J.J.H.H.M., Bindels R.J.M., Monnens L.A.H., van den Heuvel L.P.W.J., Knoers N.V.A.M. Nat. Genet. 26:265-266(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share