Gene Bio Systems
Recombinant Human Small proline-rich protein 2B(SPRR2B)
Recombinant Human Small proline-rich protein 2B(SPRR2B)
SKU:CSB-YP022613HUb1
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P35325
Gene Names: SPRR2B
Organism: Homo sapiens (Human)
AA Sequence: MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK
Expression Region: 1-72aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW: 12 kDa
Alternative Name(s):
Relevance: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.
Reference: "Structural organization and regulation of the small proline-rich family of cornified envelope precursors suggest a role in adaptive barrier function." Cabral A., Voskamp P., Cleton-Jansen A.-M., South A., Nizetic D., Backendorf C. J. Biol. Chem. 276:19231-19237(2001)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
