Gene Bio Systems
Recombinant Human SLP adapter and CSK-interacting membrane protein(SCIMP)
Recombinant Human SLP adapter and CSK-interacting membrane protein(SCIMP)
SKU:CSB-CF754405HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q6UWF3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDTFTVQDSTAMSWWRNNFWIILAVAIIVVSVGLGLILYCVCKWQLRRGKKWEIAKPLKH KQVDEEKMYENVLNESPVQLPPLPPRNWPSLEDSSPQEAPSQPPATYSLVNKVKNKKTVS IPSYIEPEDDYDDVEIPANTEKASF
Protein Names:Recommended name: SLP adapter and CSK-interacting membrane protein Alternative name(s): SLP65/SLP76, Csk-interacting membrane protein
Gene Names:Name:SCIMP Synonyms:C17orf87 ORF Names:UNQ5783/PRO16090
Expression Region:1-145
Sequence Info:full length protein
