Gene Bio Systems
Recombinant Human Secreted Ly-6-uPAR-related protein 1(SLURP1)
Recombinant Human Secreted Ly-6-uPAR-related protein 1(SLURP1)
SKU:CSB-EP021784HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cardiovascular
Uniprot ID: P55000
Gene Names: SLURP1
Organism: Homo sapiens (Human)
AA Sequence: LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
Expression Region: 23-103aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 12.9 kDa
Alternative Name(s): ARS component B ARS(component B)-81/S Anti-neoplastic urinary protein Short name:ANUP
Relevance: Has an antitumor activity. Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin.
Reference: "Biological effects of SLURP-1 on human keratinocytes."Arredondo J., Chernyavsky A.I., Webber R.J., Grando S.A.J. Invest. Dermatol. 125:1236-1241(2005)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
