Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Ribonuclease P protein subunit p25-like protein (RPP25L)

Recombinant Human Ribonuclease P protein subunit p25-like protein (RPP25L)

SKU:Q8N5L8

Regular price €675,95 EUR
Regular price Sale price €675,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cell Biology

Uniprot ID: Q8N5L8

Gene Names: RPP25L

Alternative Name(s): Rpp25-like protein

Abbreviation: Recombinant Human RPP25L protein

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 1-163aa

Protein Length: Full Length

Tag Info: N-terminal GST-tagged

Target Protein Sequence: MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS

MW: 44.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: May be a component of ribonuclease P or MRP.

Reference: "Inventory and analysis of the protein subunits of the ribonucleases P and MRP provides further evidence of homology between the yeast and human enzymes." Rosenblad M.A., Lopez M.D., Piccinelli P., Samuelsson T. Nucleic Acids Res. 34: 5145-5156(2006)

Function: May be a component of ribonuclease P or MRP.

View full details