Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Receptor-binding cancer antigen expressed on SiSo cells(EBAG9),partial

Recombinant Human Receptor-binding cancer antigen expressed on SiSo cells(EBAG9),partial

SKU:CSB-EP007355HU

Regular price €676,95 EUR
Regular price Sale price €676,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Apoptosis

Uniprot ID: O00559

Gene Names: EBAG9

Organism: Homo sapiens (Human)

AA Sequence: RSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS

Expression Region: 28-213aa

Sequence Info: Cytoplasmic Domain

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 37.2 kDa

Alternative Name(s): Cancer-associated surface antigen R;CAS1;Estrogen receptor-binding fragment-associated gene 9 protein

Relevance: May participate in suppression of cell proliferation and induces apoptotic cell death through activation of interleukin-1-beta converting enzyme (ICE)-like proteases.

Reference: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details