Recombinant Human Reactive oxygen species modulator 1(ROMO1)

SKU: CSB-CF020063HU

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P60602

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTM MQSGGTFGTFMAIGMGIRC

Protein Names:Recommended name: Reactive oxygen species modulator 1 Short name= ROS modulator 1 Alternative name(s): Epididymis tissue protein Li 175 Glyrichin Mitochondrial targeting GxxxG motif protein Short name= MTGM Protein MGR2 h

Gene Names:Name:ROMO1 Synonyms:C20orf52

Expression Region:1-79

Sequence Info:Full length protein