Gene Bio Systems
Recombinant Human Ras-related protein Rab-27B(RAB27B)
Recombinant Human Ras-related protein Rab-27B(RAB27B)
SKU:CSB-EP019178HU
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: O00194
Gene Names: RAB27B
Organism: Homo sapiens (Human)
AA Sequence: TDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
Expression Region: 2-218aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 40.5 kDa
Alternative Name(s): C25KG
Relevance: May be involved in targeting uroplakins to urothelial apical mbranes.
Reference: Molecular cloning and characterization of rab27a and rab27b, novel human rab proteins shared by melanocytes and platelets.Chen D., Guo J., Miki T., Tachibana M., Gahl W.A.Biochem. Mol. Med. 60:27-37(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
