Gene Bio Systems
Recombinant Human Putative uncharacterized protein CRYM-AS1(CRYM-AS1)
Recombinant Human Putative uncharacterized protein CRYM-AS1(CRYM-AS1)
SKU:CSB-CF015596HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:A6NIL9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDFSESEKFMVLLWKNFILKRRRCIALVVEMVLTFLFSAALLATRSVITINKNGPFDFAA QPVDEVPFYITASLISPSPLELAYVPSRSTVVQGIIERVKMDLNPQMKG
Protein Names:Recommended name: Putative uncharacterized protein CRYM-AS1 Alternative name(s): CRYM antisense RNA 1 CRYM antisense gene protein 1
Gene Names:Name:CRYM-AS1 Synonyms:NCRNA00169
Expression Region:1-109
Sequence Info:Full length protein
