Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Putative uncharacterized protein CRYM-AS1(CRYM-AS1)

Recombinant Human Putative uncharacterized protein CRYM-AS1(CRYM-AS1)

SKU:CSB-CF015596HU

Regular price €1.241,95 EUR
Regular price Sale price €1.241,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:A6NIL9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDFSESEKFMVLLWKNFILKRRRCIALVVEMVLTFLFSAALLATRSVITINKNGPFDFAA QPVDEVPFYITASLISPSPLELAYVPSRSTVVQGIIERVKMDLNPQMKG

Protein Names:Recommended name: Putative uncharacterized protein CRYM-AS1 Alternative name(s): CRYM antisense RNA 1 CRYM antisense gene protein 1

Gene Names:Name:CRYM-AS1 Synonyms:NCRNA00169

Expression Region:1-109

Sequence Info:Full length protein

View full details