Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Putative uncharacterized protein C14orf165(C14orf165)

Recombinant Human Putative uncharacterized protein C14orf165(C14orf165)

SKU:CSB-CF774799HU

Regular price €1.387,95 EUR
Regular price Sale price €1.387,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q86U02

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFTLLLSNYYSRLEGWMMDNNFSHHWKGMFPTETESTVFCLFVYLFIFVFETASGFVAQT GVHWCNLGSLQPLPPGFKRFSCLSLPSSLDYRHAPPCLANFYIFSGDRVSPCWPDWS

Protein Names:Recommended name: Putative uncharacterized protein C14orf165

Gene Names:Name:C14orf165

Expression Region:1-117

Sequence Info:full length protein

View full details