Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Protein shisa-3 homolog(SHISA3)

Recombinant Human Protein shisa-3 homolog(SHISA3)

SKU:CSB-CF021268HU

Regular price €1.497,95 EUR
Regular price Sale price €1.497,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:A0PJX4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QQSGEYCHGWVDVQGNYHEGFQCPEDFDTLDATICCGSCALRYCCAAADARLEQGGCTNDRRELEHPGITAQPVYVPFLIVGSIFIAFIILGSVVAIYCCTCLRPKEPSQQPIRFSLRSYQTETLPMILTSTSPRAPSRQSSTATSSSSTGGSIRRFSFARAEPGCLVPSPPPPYTTSHSIHLAQPSGFLVSPQYFAYPLQQEPPLPGKSCPDFSSS

Protein Names:Recommended name: Protein shisa-3 homolog

Gene Names:Name:SHISA3

Expression Region:22-238

Sequence Info:full length protein

View full details