Recombinant Human Protein S100-A11(S100A11)

Recombinant Human Protein S100-A11(S100A11)

CSB-EP020624HU
Regular price
€493,95 EUR
Sale price
€493,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: P31949

Gene Names: S100A11

Organism: Homo sapiens (Human)

AA Sequence: AKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT

Expression Region: 2-105aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 27.6 kDa

Alternative Name(s): Calgizzarin;Metastatic lymph node gene 70 protein ;MLN 70Protein S100-CS100 calcium-binding protein A11

Relevance: Facilitates the differentiation and the cornification of keratinocytes.

Reference: Human calgizzarin; one colorectal cancer-related gene selected by a large scale random cDNA sequencing and northern blot analysis.Tanaka M., Adzuma K., Iwami M., Yoshimoto K., Monden Y., Itakura M.Cancer Lett. 89:195-200(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share