Recombinant Human Protein FAM167A(FAM167A)

SKU: CSB-MP836244HU

Size: 20ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 15-25 working days

Research Topic: Others

Uniprot ID: Q96KS9

Gene Names: FAM167A

Organism: Homo sapiens (Human)

AA Sequence: MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQARLEEHTWPFPRPAAEPQASLEEGERGGQEPLLPLREAGQHPPSARSASQGARPLSTGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMRLRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFSLC

Expression Region: 1-214aa

Sequence Info: Full Length

Source: Mammalian cell

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 28.2 kDa

Alternative Name(s):

Relevance:

Reference: "Physical and transcriptional map of the critical region for keratolytic winter erythema (KWE) on chromosome 8p22-p23 between D8S550 and D8S1759." Appel S., Filter M., Reis A., Hennies H.C., Bergheim A., Ogilvie E., Arndt S., Simmons A., Lovett M., Hide W., Ramsay M., Reichwald K., Zimmermann W., Rosenthal A. Eur. J. Hum. Genet. 10:17-25(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.