Recombinant Human Pro-neuregulin-2, membrane-bound isoform(NRG2),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Pro-neuregulin-2, membrane-bound isoform(NRG2),partial

CSB-EP016078HU
Regular price
€500,95 EUR
Sale price
€500,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Neuroscience

Uniprot ID: O14511

Gene Names: NRG2

Organism: Homo sapiens (Human)

AA Sequence: CYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKR

Expression Region: 112-405aa

Sequence Info: Extracellular Domain

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 48.8 kDa

Alternative Name(s): Divergent of neuregulin-1 ;DON-1Neural- and thymus-derived activator for ERBB kinases ;NTAK

Relevance: Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor.

Reference: Ligand discrimination in signaling through an ErbB4 receptor homodimer.Sweeney C., Lai C., Riese D.J. II, Diamonti A.J., Cantley L.C., Carraway K.L. IIIJ. Biol. Chem. 275:19803-19807(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Pro-neuregulin-2, membrane-bound isoform(NRG2),partial
    Regular price
    €559,95 EUR
    Sale price
    €559,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Pro-neuregulin-3, membrane-bound isoform(NRG3),partial
    Regular price
    €500,95 EUR
    Sale price
    €500,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Pro-neuregulin-1, membrane-bound isoform protein(NRG1),partial (Active)
    Regular price
    €559,95 EUR
    Sale price
    €559,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Pro-neuregulin-1, membrane-bound isoform protein(NRG1) (Active)
    Regular price
    €559,95 EUR
    Sale price
    €559,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share