
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: Q9NRD5
Gene Names: PICK1
Organism: Homo sapiens (Human)
AA Sequence: MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQ
Expression Region: 1-200aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 48.9 kDa
Alternative Name(s): Protein interacting with C kinase 1;Protein kinase C-alpha-binding protein
Relevance: Probable adapter protein that bind to and organize the subcellular localization of a variety of mbrane proteins containing some PDZ recognition sequence. Involved in the clustering of various receptors, possibly by acting at the receptor internalization level. Plays a role in synaptic plasticity by regulating the trafficking and internalization of AMPA receptors. May be regulated upon PRKCA activation. May regulate ASIC1/ASIC3 channel. Regulates actin polymerization by inhibiting the actin-nucleating activity of the Arp2/3 complex; the function is competetive with nucleation promoting factors and is linked to neuronal morphology regulation and AMPA receptor (AMPAR) endocytosis. Via interaction with the Arp2/3 complex involved in regulation of synaptic plasicity of excitatory synapses and required for spine shrinkage during long-term depression (LTD). Involved in regulation of astrocyte morphology, antagonistic to Arp2/3 complex activator WASL/N-WASP function.
Reference: Interaction of the PDZ domain of human PICK1 with class I ADP-ribosylation factors.Takeya R., Takeshige K., Sumimoto H.Biochem. Biophys. Res. Commun. 267:149-155(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
PICK1 Antibody, Biotin conjugated - Cat. #: CSB-PA05445D0Rb
- Regular price
- €303,95 EUR
- Sale price
- €303,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
PICK1 Antibody - Cat. #: CSB-PA05445A0Rb
- Regular price
- €303,95 EUR
- Sale price
- €303,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
PICK1 Antibody, FITC conjugated - Cat. #: CSB-PA05445C0Rb
- Regular price
- €303,95 EUR
- Sale price
- €303,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
PICK1 Antibody, HRP conjugated - Cat. #: CSB-PA05445B0Rb
- Regular price
- €303,95 EUR
- Sale price
- €303,95 EUR
- Regular price
-
- Unit price
- per
Sold out