Gene Bio Systems
Recombinant Human Potassium voltage-gated channel subfamily E member 1(KCNE1)
Recombinant Human Potassium voltage-gated channel subfamily E member 1(KCNE1)
SKU:CSB-CF012025HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:P15382
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP
Protein Names:Recommended name: Potassium voltage-gated channel subfamily E member 1 Alternative name(s): Delayed rectifier potassium channel subunit IsK IKs producing slow voltage-gated potassium channel subunit beta Mink Minimal potassium channel
Gene Names:Name:KCNE1
Expression Region:1-129
Sequence Info:full length protein
