
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: P51164
Gene Names: ATP4B
Organism: Homo sapiens (Human)
AA Sequence: CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
Expression Region: 58-291aa
Sequence Info: Extracellular Domain
Source: E.coli
Tag Info: NO-Tagged
MW: 26.6 kDa
Alternative Name(s): Gastric H(+)/K(+) ATPase subunit beta Proton pump beta chain
Relevance: Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity.
Reference: "A C-terminal lobe of the beta subunit of Na,K-ATPase and H,K-ATPase resembles cell adhesion molecules." Bab-Dinitz E., Albeck S., Peleg Y., Brumfeld V., Gottschalk K.E., Karlish S.J. Biochemistry 48:8684-8691(2009)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Potassium-transporting ATPase subunit beta(ATP4B),partial
- Regular price
- €680,95 EUR
- Sale price
- €680,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Glucosidase 2 subunit beta(PRKCSH),partial
- Regular price
- €608,95 EUR
- Sale price
- €608,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Junctional adhesion molecule B(JAM2),partial
- Regular price
- €608,95 EUR
- Sale price
- €608,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Antigen KI-67(MKI67),partial
- Regular price
- €608,95 EUR
- Sale price
- €608,95 EUR
- Regular price
-
- Unit price
- per
Sold out