Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Platelet glycoprotein VI (GP6), partial (Active)

Recombinant Human Platelet glycoprotein VI (GP6), partial (Active)

SKU:Q9HCN6

Regular price €519,95 EUR
Regular price Sale price €519,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Cardiovascular

Uniprot ID: Q9HCN6

Gene Names: GP6

Alternative Name(s): Platelet glycoprotein VI ; GPVI ; Glycoprotein 6; GP6

Abbreviation: Recombinant Human GP6 protein, partial (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 21-267aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: QSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTK

MW: 28.3 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human GP6 protein at 2 μg/mL can bind Anti-GP6 recombinant antibody (CSB-RA872550MA1HU). The EC50 is 3.598-4.105 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Collagen receptor involved in collagen-induced platelet adhesion and activation. Plays a key role in platelet procoagulant activity and subsequent thrombin and fibrin formation. This procoagulant function may contribute to arterial and venous thrombus formation. The signaling pathway involves the FcR gamma-chain, the Src kinases (likely FYN or LYN) and SYK, the adapter protein LAT and leads to the activation of PLCG2.

Reference: Molecular cloning, genomic structure, chromosomal localization, and alternative splice forms of the platelet collagen receptor glycoprotein VI. Ezumi Y., Uchiyama T., Takayama H. Biochem. Biophys. Res. Commun. 277: 27-36 (2000)

Function:

View full details