Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Platelet-derived growth factor subunit B(PDGFB)

Recombinant Human Platelet-derived growth factor subunit B(PDGFB)

SKU:CSB-EP017709HUc7

Regular price €552,95 EUR
Regular price Sale price €552,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Cancer

Uniprot ID:P01127

Gene Names:PDGFB

Organism:Homo sapiens (Human)

AA Sequence:SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

Expression Region:82-190aa

Sequence Info:Full Length of Mature Protein

Source:E.coli

Tag Info:C-terminal 6xHis-tagged

MW:14.3 kDa

Alternative Name(s):PDGF-2 (Platelet-derived growth factor B chain) (Platelet-derived growth factor beta polypeptide) (Proto-oncogene c-Sis) (Becaplermin) (PDGF subunit B) (PDGF2) (SIS)

Relevance:Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA

Reference:"Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004)

Purity:Greater than 90% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-81?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 5? for up to one week.

Function:Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin

Involvement in disease:Basal ganglia calcification, idiopathic, 5 (IBGC5)

Subcellular Location:Secreted

Protein Families:PDGF/VEGF growth factor family

Tissue Specificity:Expressed at high levels in the heart, brain (sustantia nigra), placenta and fetal kidney. Expressed at moderate levels in the brain (hippocampus), skeletal muscle, kidney and lung.

Paythway:Jak-STATsignalingpathway

HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:8800

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=1976

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:5155

STRING Database Link:https://string-db.org/network/9606.ENSP00000330382

OMIM Database Link:https://www.omim.org/entry/190040190040190040

Lead Time Guidance:13-23 business days

View full details