Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Phospholemman(FXYD1)

Recombinant Human Phospholemman(FXYD1)

SKU:CSB-CF009089HU

Regular price €1.350,95 EUR
Regular price Sale price €1.350,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O00168

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR

Protein Names:Recommended name: Phospholemman Alternative name(s): FXYD domain-containing ion transport regulator 1

Gene Names:Name:FXYD1 Synonyms:PLM

Expression Region:21-92

Sequence Info:full length protein

View full details