Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Outer dense fiber protein 4(ODF4)

Recombinant Human Outer dense fiber protein 4(ODF4)

SKU:CSB-CF644805HU

Regular price €1.540,95 EUR
Regular price Sale price €1.540,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q2M2E3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTLSLSSNRSLGQ RQNSPLPFQWRITHSFRWMAQVLASELSLVAFILLLVVAFSKKWLDLSRSLFYQRWPVDV SNRIHTSAHVMSMGLLHFYKSRSCSDLENGKVTFIFSTLMLFPINIWIFELERNVSIPIG WSYFIGWLVLILYFTCAILCYFNHKSFWSLILSHPSGAVSCSSSFGSVEESPRAQTITDT PITQEGVLDPEQKDTHV

Protein Names:Recommended name: Outer dense fiber protein 4 Alternative name(s): Outer dense fiber of sperm tails protein 4 Testis-specific protein oppo 1 Short name= hOPPO1

Gene Names:Name:ODF4 Synonyms:OPPO1

Expression Region:1-257

Sequence Info:full length protein

View full details