Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human ORM1-like protein 2(ORMDL2)

Recombinant Human ORM1-like protein 2(ORMDL2)

SKU:CSB-CF690476HU

Regular price €1.435,95 EUR
Regular price Sale price €1.435,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q53FV1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHMVLLSIPFFSIPVVWTLTNVIHNLAT YVFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYD AAHFLINTASLLSVLLPKLPQFHGVRVFGINKY

Protein Names:Recommended name: ORM1-like protein 2 Alternative name(s): Adoplin-2

Gene Names:Name:ORMDL2 ORF Names:HSPC160, MSTP095

Expression Region:1-153

Sequence Info:full length protein

View full details