Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Oligodendrocyte transcription factor 1(OLIG1),partial

Recombinant Human Oligodendrocyte transcription factor 1(OLIG1),partial

SKU:CSB-YP016328HU

Regular price €810,95 EUR
Regular price Sale price €810,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Neuroscience

Uniprot ID:Q8TAK6

Gene Names:OLIG1

Organism:Homo sapiens (Human)

AA Sequence:MLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQ

Expression Region:17-105aa

Sequence Info:Partial

Source:Yeast

Tag Info:N-terminal 6xHis-tagged

MW:11.1 kDa

Alternative Name(s):Class B basic helix-loop-helix protein 6 Short name: bHLHb6 Class E basic helix-loop-helix protein 21 Short name: bHLHe21

Relevance:Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube

Reference:"Exhaustive identification of human class II basic helix-loop-helix proteins by virtual library screening." McLellan A.S., Langlands K., Kealey T. Mech. Dev. 119:S285-S291(2002)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube (By similarity).

Involvement in disease:

Subcellular Location:Nucleus

Protein Families:

Tissue Specificity:Expressed in the brain, in oligodendrocytes. Strongly expressed in oligodendrogliomas, while expression is weak to moderate in astrocytomas. Expression in glioblastomas is highly variable.

Paythway:

HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:16983

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=56663

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:116448

STRING Database Link:https://string-db.org/network/9606.ENSP00000371785

OMIM Database Link:https://www.omim.org/entry/606385606385606385

Lead Time Guidance:25-35 business days

View full details