Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Nucleolar protein 3(NOL3)

Recombinant Human Nucleolar protein 3(NOL3)

SKU:CSB-EP015921HU

Regular price €606,95 EUR
Regular price Sale price €606,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Apoptosis

Uniprot ID: O60936

Gene Names: NOL3

Organism: Homo sapiens (Human)

AA Sequence: MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS

Expression Region: 1-208aa

Sequence Info: Full Length of Isoform 2

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 38.6 kDa

Alternative Name(s): Apoptosis repressor with CARD1

Relevance: Isoform 1: May be involved in RNA splicing.

Reference: Screening of mutations in NOL3 in a myoclonic syndromes series.Macerollo A., Mencacci N.E., Erro R., Cordivari C., Edwards M.J., Wood N.W., Bhatia K.P.J. Neurol. 261:1830-1831(2014)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details