Skip to product information
1 of 1

GeneBio Systems

Recombinant Human NKG2-C type II integral membrane protein (KLRC2), partial

Recombinant Human NKG2-C type II integral membrane protein (KLRC2), partial

SKU:P26717

Regular price €485,95 EUR
Regular price Sale price €485,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Immunology

Uniprot ID: P26717

Gene Names: KLRC2

Alternative Name(s): CD159 antigen-like family member CNK cell receptor CNKG2-C-activating NK receptor; CD159c

Abbreviation: Recombinant Human KLRC2 protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 94-231aa

Protein Length: Extracellular Domain

Tag Info: N-terminal 6xHis-SUMO-tagged

Target Protein Sequence: IPFLEQNNSSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL

MW: 31.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.

Reference: The structural basis for intramembrane assembly of an activating immunoreceptor complex.Call M.E., Wucherpfennig K.W., Chou J.J.Nat. Immunol. 11: 1023-1029(2010)

Function: Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.

View full details