Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Neurensin-1(NRSN1)

Recombinant Human Neurensin-1(NRSN1)

SKU:CSB-CF815587HU

Regular price €1.478,95 EUR
Regular price Sale price €1.478,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q8IZ57

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSCSNVCGSRQAQAAAEGGYQRYGVRSYLHQFYEDCTASIWEYEDDFQIQRSPNRWSSV FWKVGLISGTVFVILGLTVLAVGFLVPPKIEAFGEADFVVVDTHAVQFNSALDMYKLAGA VLFCIGGTSMAGCLLMSVFVKSYSKEEKFLQQKFKERIADIKAHTQPVTKAPGPGETKIP VTLSRVQNVQPLLAT

Protein Names:Recommended name: Neurensin-1 Alternative name(s): Neuro-p24 Vesicular membrane protein of 24 kDa Short name= Vesicular membrane protein p24

Gene Names:Name:NRSN1 Synonyms:VMP

Expression Region:1-195

Sequence Info:full length protein

View full details