Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3(NDUFB3)

SKU: CSB-CF015645HU

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O43676

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSV SFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH

Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 Alternative name(s): Complex I-B12 Short name= CI-B12 NADH-ubiquinone oxidoreductase B12 subunit

Gene Names:Name:NDUFB3

Expression Region:2-98

Sequence Info:Full length protein