Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Myosin regulatory light chain 2, ventricular-cardiac muscle isoform(MYL2),partial

Recombinant Human Myosin regulatory light chain 2, ventricular-cardiac muscle isoform(MYL2),partial

SKU:CSB-RP100574h

Regular price €606,95 EUR
Regular price Sale price €606,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cardiovascular

Uniprot ID: P10916

Gene Names: MYL2

Organism: Homo sapiens (Human)

AA Sequence: KRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEE

Expression Region: 8-164aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 21.8 kDa

Alternative Name(s):

Relevance:

Reference: ErratumRichard P., Charron P., Carrier L., Ledeuil C., Cheav T., Pichereau C., Benaiche A., Isnard R., Dubourg O., Burban M., Gueffet J.-P., Millaire A., Desnos M., Schwartz K., Hainque B., Komajda M.Circulation 109:3258-3258(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details