Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Monocyte to macrophage differentiation factor 2(MMD2)

Recombinant Human Monocyte to macrophage differentiation factor 2(MMD2)

SKU:CSB-CF814229HU

Regular price €1.554,95 EUR
Regular price Sale price €1.554,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q8IY49

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSILGSSNLYFLS DDDWETISAWIYGLGLCGLFVVSTVFHTISWKKSHLRMVEHCLHMFDRMVIYFFIAASYA PWLNLRELGPWASHMRWLVWIMASVGTIYVFFFHERTGSCVQFLRGEACPKAGTACLPAR YKLVELLCYVVMGFFPALVILSMPNTEGIWELVTGGVFYCLGMVFFKSDGRIPFAHAIWH LFVAFGAGTHYYAIWRYLYLPSTLQTKVSK

Protein Names:Recommended name: Monocyte to macrophage differentiation factor 2 Alternative name(s): Progestin and adipoQ receptor family member 10 Progestin and adipoQ receptor family member X

Gene Names:Name:MMD2 Synonyms:PAQR10

Expression Region:1-270

Sequence Info:full length protein

View full details