Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Metalloproteinase inhibitor 3(TIMP3),partial

Recombinant Human Metalloproteinase inhibitor 3(TIMP3),partial

SKU:CSB-RP117494h

Regular price €675,95 EUR
Regular price Sale price €675,95 EUR
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Neuroscience

Target / Protein: TIMP3

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: P35625

AA Sequence: HPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINA

Tag info: N-terminal 6xHis-tagged

Expression Region: 30-208aa

Protein length: Partial

MW: 24.8 kDa

Alternative Name(s): Protein MIG-5Tissue inhibitor of metalloproteinases 3 ;TIMP-3

Relevance: Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates th by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to rodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15.

Reference: Structure and expression in breast tumors of human TIMP-3, a new member of the metalloproteinase inhibitor family.Uria J.A., Ferrando A.A., Velasco G., Freije J.M., Lopez-Otin C.Cancer Res. 54:2091-2094(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details