Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Mediator of RNA polymerase II transcription subunit 1(MED1),partial

Recombinant Human Mediator of RNA polymerase II transcription subunit 1(MED1),partial

SKU:CSB-EP621880HU

Regular price €873,95 EUR
Regular price Sale price €873,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Epigenetics and Nuclear Signaling

Uniprot ID: Q15648

Gene Names: MED1

Organism: Homo sapiens (Human)

AA Sequence: FGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPF

Expression Region: 878-1031aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 32.2 kDa

Alternative Name(s): Activator-recruited cofactor 205KDA component Short name: ARC205 Mediator complex subunit 1 Peroxisome proliferator-activated receptor-binding protein Short name: PBP Short name: PPAR-binding protein Thyroid hormone receptor-associated protein complex 220KDA component Short name: Trap220 Thyroid receptor-interacting protein 2 Short name: TR-interacting protein 2 Short name: TRIP-2 Vitamin D receptor-interacting protein complex component DRIP205 p53 regulatory protein RB18A

Relevance: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (PubMed:10406464, PubMed:11867769, PubMed:12037571, PubMed:12218053, PubMed:12556447, PubMed:14636573, PubMed:15340084, PubMed:15471764, PubMed:15989967, PubMed:16574658, PubMed:9653119). Acts as a coactivator for GATA1-mediated transcriptional activation during erythroid differentiation of K562 erythroleukemia cells (PubMed:24245781).

Reference: "The TRAP220 component of a thyroid hormone receptor-associated protein (TRAP) coactivator complex interacts directly with nuclear receptors in a ligand-dependent fashion."Yuan C.-X., Ito M., Fondell J.D., Fu Z.-Y., Roeder R.G.Proc. Natl. Acad. Sci. U.S.A. 95:7939-7944(1998).

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details