Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Lysosomal-associated transmembrane protein 4A(LAPTM4A)

Recombinant Human Lysosomal-associated transmembrane protein 4A(LAPTM4A)

SKU:CSB-CF621858HU

Regular price €1.517,95 EUR
Regular price Sale price €1.517,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q15012

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVSMSFKRNRSDRFYSTRCCGCCHVRTGTIILGTWYMVVNLLMAILLTVEVTHPNSMPAV NIQYEVIGNYYSSERMADNACVLFAVSVLMFIISSMLVYGAISYQVGWLIPFFCYRLFDF VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFALFIIFKAYLI NCVWNCYKYINNRNVPEIAVYPAFEAPPQYVLPTYEMAVKMPEKEPPPPYLPA

Protein Names:Recommended name: Lysosomal-associated transmembrane protein 4A Alternative name(s): Golgi 4-transmembrane-spanning transporter MTP

Gene Names:Name:LAPTM4A Synonyms:KIAA0108, LAPTM4, MBNT, MTRP ORF Names:UNQ1846/PRO3574

Expression Region:1-233

Sequence Info:full length protein

View full details