Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Lymphocyte antigen 6 complex locus protein G6d(LY6G6D),partial

Recombinant Human Lymphocyte antigen 6 complex locus protein G6d(LY6G6D),partial

SKU:CSB-EP013246HU1

Regular price €680,95 EUR
Regular price Sale price €680,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Signal Transduction

Uniprot ID: O95868

Gene Names: LY6G6D

Organism: Homo sapiens (Human)

AA Sequence: LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Expression Region: 10-104aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 10xHis-B2M-JD-tagged

MW: 15.5 kDa

Alternative Name(s): Megakaryocyte-enhanced gene transcript 1 protein

Relevance:

Reference: "Genes encoding three new members of the leukocyte antigen 6 superfamily and a novel member of Ig superfamily, together with genes encoding the regulatory nuclear chloride ion channel protein (hRNCC) and an N omega-N omega-dimethylarginine dimethylaminohydrolase homologue, are found in a 30-kb segment of the MHC class III region." Ribas G., Neville M., Wixon J.L., Cheng J., Campbell R.D. J. Immunol. 163:278-287(1999)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details