Gene Bio Systems
Recombinant Human Lymphocyte antigen 6 complex locus protein G6d(LY6G6D)
Recombinant Human Lymphocyte antigen 6 complex locus protein G6d(LY6G6D)
SKU:CSB-EP013246HU
Couldn't load pickup availability
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Others
Target / Protein: LY6G6D
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: O95868
AA Sequence: NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS
Tag info: N-terminal 10xHis-B2M-tagged
Expression Region: 20-104aa
Protein length: Full Length of Mature Protein
MW: 25.5 kDa
Alternative Name(s): Megakaryocyte-enhanced gene transcript 1 protein C6orf23, G6D, MEGT1, NG25
Relevance:
Reference: "Transcriptional analysis of a novel cluster of LY-6 family members in the human and mouse major histocompatibility complex: five genes with many splice forms." Mallya M., Campbell R.D., Aguado B. Genomics 80:113-123(2002)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
