Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A(FCGR3A)

SKU: CSB-CF008543HU

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P08637

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKDPQDK

Protein Names:Recommended name: Low affinity immunoglobulin gamma Fc region receptor III-A Alternative name(s): CD16a antigen Fc-gamma RIII-alpha Short name= Fc-gamma RIII Short name= Fc-gamma RIIIa Short name= FcRIII Short name= FcRIIIa FcR-10 IgG Fc receptor III-2 CD_antigen= CD16a

Gene Names:Name:FCGR3A Synonyms:CD16A, FCG3, FCGR3, IGFR3

Expression Region:17-254

Sequence Info:full length protein