Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A), partial (Active)

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A), partial (Active)

SKU:P12318

Regular price €399,95 EUR
Regular price Sale price €399,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Immunology

Uniprot ID: P12318

Gene Names: FCGR2A

Alternative Name(s): Low affinity immunoglobulin gamma Fc region receptor II-a; IgG Fc receptor II-a; CDw32; Fc-gamma RII-a (Fc-gamma-RIIa; FcRII-a); CD32; FCGR2A; CD32, FCG2, FCGR2A1, IGFR2

Abbreviation: Recombinant Human FCGR2A protein, partial (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 34-217aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMG

MW: 23.2 kDa

Purity: Greater than 95% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human FCGR2A at 2 μg/mL can bind Anti-FCGR2A recombinant antibody (CSB-RA008540MA1HU). The EC50 is 24.44-32.57 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.

Reference: The DNA sequence and biological annotation of human chromosome 1. Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Bentley D.R. Nature 441: 315-321 (2006)

Function:

View full details