Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Linker for activation of T-cells family member 1(LAT)

Recombinant Human Linker for activation of T-cells family member 1(LAT)

SKU:CSB-CF012767HU

Regular price €1.543,95 EUR
Regular price Sale price €1.543,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O43561

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN

Protein Names:Recommended name: Linker for activation of T-cells family member 1 Alternative name(s): 36 kDa phospho-tyrosine adapter protein Short name= pp36 p36-38

Gene Names:Name:LAT

Expression Region:1-262

Sequence Info:full length protein

View full details