Gene Bio Systems
Recombinant Human Killer cell immunoglobulin-like receptor 3DL2(KIR3DL2)
Recombinant Human Killer cell immunoglobulin-like receptor 3DL2(KIR3DL2)
SKU:CSB-CF012365HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:P43630
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLHVLIGTSVVIFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQLDHCVFIQRKISRPSQRPKTPLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF
Protein Names:Recommended name: Killer cell immunoglobulin-like receptor 3DL2 Alternative name(s): CD158 antigen-like family member K MHC class I NK cell receptor Natural killer-associated transcript 4 Short name= NKAT-4 p70 natural killer cell receptor clone CL-5 Short name= p70 NK receptor CL-5 CD_antigen= CD158k
Gene Names:Name:KIR3DL2 Synonyms:CD158K, NKAT4
Expression Region:22-455
Sequence Info:full length protein
