Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Kallikrein-2(KLK2)

Recombinant Human Kallikrein-2(KLK2)

SKU:CSB-EP012453HU

Regular price €673,95 EUR
Regular price Sale price €673,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Signal Transduction

Uniprot ID: P20151

Gene Names: KLK2

Organism: Homo sapiens (Human)

AA Sequence: IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP

Expression Region: 25-261aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 30.2 kDa

Alternative Name(s): Glandular kallikrein-1

Relevance: Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.

Reference: "Primary structure of a human glandular kallikrein gene." Schedlich L.J., Bennetts B.H., Morris B.J. DNA 6:429-437(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details